Anti NOXO1 pAb (ATL-HPA071540)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071540-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NOXO1
Alternative Gene Name: P41NOXA, P41NOXB, P41NOXC, SH3PXD5, SNX28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019320: 59%, ENSRNOG00000025117: 62%
Entrez Gene ID: 124056
Uniprot ID: Q8NFA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLETYSRRLLATAERVARSPTITGFFAPQPLDLE |
Gene Sequence | LLETYSRRLLATAERVARSPTITGFFAPQPLDLE |
Gene ID - Mouse | ENSMUSG00000019320 |
Gene ID - Rat | ENSRNOG00000025117 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOXO1 pAb (ATL-HPA071540) | |
Datasheet | Anti NOXO1 pAb (ATL-HPA071540) Datasheet (External Link) |
Vendor Page | Anti NOXO1 pAb (ATL-HPA071540) at Atlas Antibodies |
Documents & Links for Anti NOXO1 pAb (ATL-HPA071540) | |
Datasheet | Anti NOXO1 pAb (ATL-HPA071540) Datasheet (External Link) |
Vendor Page | Anti NOXO1 pAb (ATL-HPA071540) |