Anti NOV pAb (ATL-HPA019684 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019684-25

Protein Description: nephroblastoma overexpressed
Gene Name: NOV
Alternative Gene Name: CCN3, IGFBP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037362: 81%, ENSRNOG00000008697: 80%
Entrez Gene ID: 4856
Uniprot ID: P48745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
• Gene Sequence: SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
• Gene ID - Mouse: ENSMUSG00000037362
• Gene ID - Rat: ENSRNOG00000008697
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NOV pAb (ATL-HPA019684 w/enhanced validation) – 1 Found

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933.