Anti NOS1AP pAb (ATL-HPA055561)

Atlas Antibodies

Catalog No.:
ATL-HPA055561-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nitric oxide synthase 1 (neuronal) adaptor protein
Gene Name: NOS1AP
Alternative Gene Name: CAPON, KIAA0464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038473: 94%, ENSRNOG00000042929: 95%
Entrez Gene ID: 9722
Uniprot ID: O75052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
Gene Sequence KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
Gene ID - Mouse ENSMUSG00000038473
Gene ID - Rat ENSRNOG00000042929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOS1AP pAb (ATL-HPA055561)
Datasheet Anti NOS1AP pAb (ATL-HPA055561) Datasheet (External Link)
Vendor Page Anti NOS1AP pAb (ATL-HPA055561) at Atlas Antibodies

Documents & Links for Anti NOS1AP pAb (ATL-HPA055561)
Datasheet Anti NOS1AP pAb (ATL-HPA055561) Datasheet (External Link)
Vendor Page Anti NOS1AP pAb (ATL-HPA055561)