Anti NOS1 pAb (ATL-HPA069509)
Atlas Antibodies
- SKU:
- ATL-HPA069509-25
- Shipping:
- Calculated at Checkout
$328.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 91%, ENSRNOG00000001130: 91%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD |
Gene Sequence | DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD |
Gene ID - Mouse | ENSMUSG00000029361 |
Gene ID - Rat | ENSRNOG00000001130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOS1 pAb (ATL-HPA069509) | |
Datasheet | Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link) |
Vendor Page | Anti NOS1 pAb (ATL-HPA069509) at Atlas Antibodies |
Documents & Links for Anti NOS1 pAb (ATL-HPA069509) | |
Datasheet | Anti NOS1 pAb (ATL-HPA069509) Datasheet (External Link) |
Vendor Page | Anti NOS1 pAb (ATL-HPA069509) |