Anti NOLC1 pAb (ATL-HPA050388)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050388-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NOLC1
Alternative Gene Name: KIAA0035, NOPP130, NOPP140, P130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015176: 87%, ENSRNOG00000018704: 87%
Entrez Gene ID: 9221
Uniprot ID: Q14978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF |
| Gene Sequence | VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF |
| Gene ID - Mouse | ENSMUSG00000015176 |
| Gene ID - Rat | ENSRNOG00000018704 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NOLC1 pAb (ATL-HPA050388) | |
| Datasheet | Anti NOLC1 pAb (ATL-HPA050388) Datasheet (External Link) |
| Vendor Page | Anti NOLC1 pAb (ATL-HPA050388) at Atlas Antibodies |
| Documents & Links for Anti NOLC1 pAb (ATL-HPA050388) | |
| Datasheet | Anti NOLC1 pAb (ATL-HPA050388) Datasheet (External Link) |
| Vendor Page | Anti NOLC1 pAb (ATL-HPA050388) |