Anti NOLC1 pAb (ATL-HPA050388)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050388-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NOLC1
Alternative Gene Name: KIAA0035, NOPP130, NOPP140, P130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015176: 87%, ENSRNOG00000018704: 87%
Entrez Gene ID: 9221
Uniprot ID: Q14978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF |
Gene Sequence | VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF |
Gene ID - Mouse | ENSMUSG00000015176 |
Gene ID - Rat | ENSRNOG00000018704 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOLC1 pAb (ATL-HPA050388) | |
Datasheet | Anti NOLC1 pAb (ATL-HPA050388) Datasheet (External Link) |
Vendor Page | Anti NOLC1 pAb (ATL-HPA050388) at Atlas Antibodies |
Documents & Links for Anti NOLC1 pAb (ATL-HPA050388) | |
Datasheet | Anti NOLC1 pAb (ATL-HPA050388) Datasheet (External Link) |
Vendor Page | Anti NOLC1 pAb (ATL-HPA050388) |