Anti NOL9 pAb (ATL-HPA036347)

Atlas Antibodies

Catalog No.:
ATL-HPA036347-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nucleolar protein 9
Gene Name: NOL9
Alternative Gene Name: FLJ23323, Grc3, NET6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028948: 43%, ENSRNOG00000010109: 46%
Entrez Gene ID: 79707
Uniprot ID: Q5SY16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEE
Gene Sequence FSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEE
Gene ID - Mouse ENSMUSG00000028948
Gene ID - Rat ENSRNOG00000010109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOL9 pAb (ATL-HPA036347)
Datasheet Anti NOL9 pAb (ATL-HPA036347) Datasheet (External Link)
Vendor Page Anti NOL9 pAb (ATL-HPA036347) at Atlas Antibodies

Documents & Links for Anti NOL9 pAb (ATL-HPA036347)
Datasheet Anti NOL9 pAb (ATL-HPA036347) Datasheet (External Link)
Vendor Page Anti NOL9 pAb (ATL-HPA036347)