Anti NOL9 pAb (ATL-HPA036347)

Atlas Antibodies

Catalog No.: ATL-HPA036347-25

Protein Description: nucleolar protein 9
Gene Name: NOL9
Alternative Gene Name: FLJ23323, Grc3, NET6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028948: 43%, ENSRNOG00000010109: 46%
Entrez Gene ID: 79707
Uniprot ID: Q5SY16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEE
• Gene Sequence: FSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEE
• Gene ID - Mouse: ENSMUSG00000028948
• Gene ID - Rat: ENSRNOG00000010109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.