Anti NOL7 pAb (ATL-HPA029185)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029185-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NOL7
Alternative Gene Name: C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063200: 82%, ENSRNOG00000017904: 85%
Entrez Gene ID: 51406
Uniprot ID: Q9UMY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKL |
| Gene Sequence | EPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKL |
| Gene ID - Mouse | ENSMUSG00000063200 |
| Gene ID - Rat | ENSRNOG00000017904 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NOL7 pAb (ATL-HPA029185) | |
| Datasheet | Anti NOL7 pAb (ATL-HPA029185) Datasheet (External Link) |
| Vendor Page | Anti NOL7 pAb (ATL-HPA029185) at Atlas Antibodies |
| Documents & Links for Anti NOL7 pAb (ATL-HPA029185) | |
| Datasheet | Anti NOL7 pAb (ATL-HPA029185) Datasheet (External Link) |
| Vendor Page | Anti NOL7 pAb (ATL-HPA029185) |