Anti NOL6 pAb (ATL-HPA055891)

Atlas Antibodies

SKU:
ATL-HPA055891-25
  • Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleolar protein 6 (RNA-associated)
Gene Name: NOL6
Alternative Gene Name: bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838, Nrap, UTP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028430: 91%, ENSRNOG00000010409: 93%
Entrez Gene ID: 65083
Uniprot ID: Q9H6R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Gene Sequence GPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Gene ID - Mouse ENSMUSG00000028430
Gene ID - Rat ENSRNOG00000010409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NOL6 pAb (ATL-HPA055891)
Datasheet Anti NOL6 pAb (ATL-HPA055891) Datasheet (External Link)
Vendor Page Anti NOL6 pAb (ATL-HPA055891) at Atlas Antibodies

Documents & Links for Anti NOL6 pAb (ATL-HPA055891)
Datasheet Anti NOL6 pAb (ATL-HPA055891) Datasheet (External Link)
Vendor Page Anti NOL6 pAb (ATL-HPA055891)