Anti NOL11 pAb (ATL-HPA022010)

Atlas Antibodies

Catalog No.: ATL-HPA022010-25

Protein Description: nucleolar protein 11
Gene Name: NOL11
Alternative Gene Name: DKFZP586L0724
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018433: 86%, ENSRNOG00000052934: 87%
Entrez Gene ID: 25926
Uniprot ID: Q9H8H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
• Gene Sequence: FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
• Gene ID - Mouse: ENSMUSG00000018433
• Gene ID - Rat: ENSRNOG00000052934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NOL11 pAb (ATL-HPA022010) – 3 Found

Hayashi, Yuki; Fujimura, Akiko; Kato, Kazashi; Udagawa, Rina; Hirota, Toru; Kimura, Keiji. Nucleolar integrity during interphase supports faithful Cdk1 activation and mitotic entry. Science Advances. 2018;4(6):eaap7777. 

Freed, Emily F; Prieto, José-Luis; McCann, Kathleen L; McStay, Brian; Baserga, Susan J. NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing. Plos Genetics. 8(8):e1002892. 

Griffin, John N; Sondalle, Samuel B; Del Viso, Florencia; Baserga, Susan J; Khokha, Mustafa K. The ribosome biogenesis factor Nol11 is required for optimal rDNA transcription and craniofacial development in Xenopus. Plos Genetics. 2015;11(3):e1005018.