Anti NOD1 pAb (ATL-HPA074367)

Atlas Antibodies

SKU: ATL-HPA074367-25

• 

Protein Description: nucleotide-binding oligomerization domain containing 1
Gene Name: NOD1
Alternative Gene Name: CARD4, CLR7.1, NLRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038058: 86%, ENSRNOG00000010629: 88%
Entrez Gene ID: 10392
Uniprot ID: Q9Y239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
• Gene Sequence: NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
• Gene ID - Mouse: ENSMUSG00000038058
• Gene ID - Rat: ENSRNOG00000010629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.