Anti NOCT pAb (ATL-HPA053714)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053714-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NOCT
Alternative Gene Name: Ccr4c, CCR4L, CCRN4L, NOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023087: 88%, ENSRNOG00000010799: 88%
Entrez Gene ID: 25819
Uniprot ID: Q9UK39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW |
Gene Sequence | ARSCSRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQW |
Gene ID - Mouse | ENSMUSG00000023087 |
Gene ID - Rat | ENSRNOG00000010799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOCT pAb (ATL-HPA053714) | |
Datasheet | Anti NOCT pAb (ATL-HPA053714) Datasheet (External Link) |
Vendor Page | Anti NOCT pAb (ATL-HPA053714) at Atlas Antibodies |
Documents & Links for Anti NOCT pAb (ATL-HPA053714) | |
Datasheet | Anti NOCT pAb (ATL-HPA053714) Datasheet (External Link) |
Vendor Page | Anti NOCT pAb (ATL-HPA053714) |