Anti NOC4L pAb (ATL-HPA053424)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053424-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NOC4L
Alternative Gene Name: MGC3162, NET49, UTP19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033294: 76%, ENSRNOG00000037478: 78%
Entrez Gene ID: 79050
Uniprot ID: Q9BVI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN |
Gene Sequence | GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN |
Gene ID - Mouse | ENSMUSG00000033294 |
Gene ID - Rat | ENSRNOG00000037478 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NOC4L pAb (ATL-HPA053424) | |
Datasheet | Anti NOC4L pAb (ATL-HPA053424) Datasheet (External Link) |
Vendor Page | Anti NOC4L pAb (ATL-HPA053424) at Atlas Antibodies |
Documents & Links for Anti NOC4L pAb (ATL-HPA053424) | |
Datasheet | Anti NOC4L pAb (ATL-HPA053424) Datasheet (External Link) |
Vendor Page | Anti NOC4L pAb (ATL-HPA053424) |