Anti NOC4L pAb (ATL-HPA053424)

Atlas Antibodies

Catalog No.:
ATL-HPA053424-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleolar complex associated 4 homolog
Gene Name: NOC4L
Alternative Gene Name: MGC3162, NET49, UTP19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033294: 76%, ENSRNOG00000037478: 78%
Entrez Gene ID: 79050
Uniprot ID: Q9BVI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN
Gene Sequence GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN
Gene ID - Mouse ENSMUSG00000033294
Gene ID - Rat ENSRNOG00000037478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOC4L pAb (ATL-HPA053424)
Datasheet Anti NOC4L pAb (ATL-HPA053424) Datasheet (External Link)
Vendor Page Anti NOC4L pAb (ATL-HPA053424) at Atlas Antibodies

Documents & Links for Anti NOC4L pAb (ATL-HPA053424)
Datasheet Anti NOC4L pAb (ATL-HPA053424) Datasheet (External Link)
Vendor Page Anti NOC4L pAb (ATL-HPA053424)