Anti NOC3L pAb (ATL-HPA070981)

Atlas Antibodies

SKU: ATL-HPA070981-25

• 

Protein Description: NOC3-like DNA replication regulator
Gene Name: NOC3L
Alternative Gene Name: AD24, C10orf117, FAD24, FLJ12820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024999: 80%, ENSRNOG00000013965: 83%
Entrez Gene ID: 64318
Uniprot ID: Q8WTT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
• Gene Sequence: GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
• Gene ID - Mouse: ENSMUSG00000024999
• Gene ID - Rat: ENSRNOG00000013965
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.