Anti NOC3L pAb (ATL-HPA070981)

Atlas Antibodies

Catalog No.:
ATL-HPA070981-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NOC3-like DNA replication regulator
Gene Name: NOC3L
Alternative Gene Name: AD24, C10orf117, FAD24, FLJ12820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024999: 80%, ENSRNOG00000013965: 83%
Entrez Gene ID: 64318
Uniprot ID: Q8WTT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
Gene Sequence GSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATES
Gene ID - Mouse ENSMUSG00000024999
Gene ID - Rat ENSRNOG00000013965
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOC3L pAb (ATL-HPA070981)
Datasheet Anti NOC3L pAb (ATL-HPA070981) Datasheet (External Link)
Vendor Page Anti NOC3L pAb (ATL-HPA070981) at Atlas Antibodies

Documents & Links for Anti NOC3L pAb (ATL-HPA070981)
Datasheet Anti NOC3L pAb (ATL-HPA070981) Datasheet (External Link)
Vendor Page Anti NOC3L pAb (ATL-HPA070981)