Anti NOC2L pAb (ATL-HPA062195)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062195-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NOC2L
Alternative Gene Name: DKFZP564C186, NET15, NET7, NIR, PPP1R112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095567: 76%, ENSRNOG00000021392: 79%
Entrez Gene ID: 26155
Uniprot ID: Q9Y3T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS |
| Gene Sequence | LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS |
| Gene ID - Mouse | ENSMUSG00000095567 |
| Gene ID - Rat | ENSRNOG00000021392 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NOC2L pAb (ATL-HPA062195) | |
| Datasheet | Anti NOC2L pAb (ATL-HPA062195) Datasheet (External Link) |
| Vendor Page | Anti NOC2L pAb (ATL-HPA062195) at Atlas Antibodies |
| Documents & Links for Anti NOC2L pAb (ATL-HPA062195) | |
| Datasheet | Anti NOC2L pAb (ATL-HPA062195) Datasheet (External Link) |
| Vendor Page | Anti NOC2L pAb (ATL-HPA062195) |