Anti NNT pAb (ATL-HPA004829 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004829-25

Protein Description: nicotinamide nucleotide transhydrogenase
Gene Name: NNT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025453: 86%, ENSRNOG00000026842: 87%
Entrez Gene ID: 23530
Uniprot ID: Q13423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
• Gene Sequence: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
• Gene ID - Mouse: ENSMUSG00000025453
• Gene ID - Rat: ENSRNOG00000026842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NNT pAb (ATL-HPA004829 w/enhanced validation) – 4 Found

Gal, Jozsef; Chen, Jing; Katsumata, Yuriko; Fardo, David W; Wang, Wang-Xia; Artiushin, Sergey; Price, Douglas; Anderson, Sonya; Patel, Ela; Zhu, Haining; Nelson, Peter T. Detergent Insoluble Proteins and Inclusion Body-Like Structures Immunoreactive for PRKDC/DNA-PK/DNA-PKcs, FTL, NNT, and AIFM1 in the Amygdala of Cognitively Impaired Elderly Persons. Journal Of Neuropathology And Experimental Neurology. 2018;77(1):21-39. 

Chortis, Vasileios; Taylor, Angela E; Doig, Craig L; Walsh, Mark D; Meimaridou, Eirini; Jenkinson, Carl; Rodriguez-Blanco, Giovanny; Ronchi, Cristina L; Jafri, Alisha; Metherell, Louise A; Hebenstreit, Daniel; Dunn, Warwick B; Arlt, Wiebke; Foster, Paul A. Nicotinamide Nucleotide Transhydrogenase as a Novel Treatment Target in Adrenocortical Carcinoma. Endocrinology. 2018;159(8):2836-2849. 

Meimaridou, E; Goldsworthy, M; Chortis, V; Fragouli, E; Foster, P A; Arlt, W; Cox, R; Metherell, L A. NNT is a key regulator of adrenal redox homeostasis and steroidogenesis in male mice. The Journal Of Endocrinology. 2018;236(1):13-28. 

Williams, Jack L; Paudyal, Anju; Awad, Sherine; Nicholson, James; Grzesik, Dominika; Botta, Joaquin; Meimaridou, Eirini; Maharaj, Avinaash V; Stewart, Michelle; Tinker, Andrew; Cox, Roger D; Metherell, Lou A. Mylk3 null C57BL/6N mice develop cardiomyopathy, whereas Nnt null C57BL/6J mice do not. Life Science Alliance. 2020;3(4)