Anti NMUR1 pAb (ATL-HPA027895)

Atlas Antibodies

Catalog No.: ATL-HPA027895-25

Protein Description: neuromedin U receptor 1
Gene Name: NMUR1
Alternative Gene Name: FM-3, GPC-R, GPR66, NMU1R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026237: 62%, ENSRNOG00000018521: 44%
Entrez Gene ID: 10316
Uniprot ID: Q9HB89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
• Gene Sequence: TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
• Gene ID - Mouse: ENSMUSG00000026237
• Gene ID - Rat: ENSRNOG00000018521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.