Anti NMRK2 pAb (ATL-HPA072450)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072450-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NMRK2
Alternative Gene Name: ITGB1BP3, MIBP, NRK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004939: 35%, ENSRNOG00000020377: 34%
Entrez Gene ID: 27231
Uniprot ID: Q9NPI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM |
Gene Sequence | VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM |
Gene ID - Mouse | ENSMUSG00000004939 |
Gene ID - Rat | ENSRNOG00000020377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NMRK2 pAb (ATL-HPA072450) | |
Datasheet | Anti NMRK2 pAb (ATL-HPA072450) Datasheet (External Link) |
Vendor Page | Anti NMRK2 pAb (ATL-HPA072450) at Atlas Antibodies |
Documents & Links for Anti NMRK2 pAb (ATL-HPA072450) | |
Datasheet | Anti NMRK2 pAb (ATL-HPA072450) Datasheet (External Link) |
Vendor Page | Anti NMRK2 pAb (ATL-HPA072450) |