Anti NMNAT3 pAb (ATL-HPA057402)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057402-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NMNAT3
Alternative Gene Name: PNAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032456: 84%, ENSRNOG00000013585: 83%
Entrez Gene ID: 349565
Uniprot ID: Q96T66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV |
| Gene Sequence | VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV |
| Gene ID - Mouse | ENSMUSG00000032456 |
| Gene ID - Rat | ENSRNOG00000013585 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NMNAT3 pAb (ATL-HPA057402) | |
| Datasheet | Anti NMNAT3 pAb (ATL-HPA057402) Datasheet (External Link) |
| Vendor Page | Anti NMNAT3 pAb (ATL-HPA057402) at Atlas Antibodies |
| Documents & Links for Anti NMNAT3 pAb (ATL-HPA057402) | |
| Datasheet | Anti NMNAT3 pAb (ATL-HPA057402) Datasheet (External Link) |
| Vendor Page | Anti NMNAT3 pAb (ATL-HPA057402) |