Anti NMNAT3 pAb (ATL-HPA057402)

Atlas Antibodies

Catalog No.:
ATL-HPA057402-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nicotinamide nucleotide adenylyltransferase 3
Gene Name: NMNAT3
Alternative Gene Name: PNAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032456: 84%, ENSRNOG00000013585: 83%
Entrez Gene ID: 349565
Uniprot ID: Q96T66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV
Gene Sequence VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV
Gene ID - Mouse ENSMUSG00000032456
Gene ID - Rat ENSRNOG00000013585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NMNAT3 pAb (ATL-HPA057402)
Datasheet Anti NMNAT3 pAb (ATL-HPA057402) Datasheet (External Link)
Vendor Page Anti NMNAT3 pAb (ATL-HPA057402) at Atlas Antibodies

Documents & Links for Anti NMNAT3 pAb (ATL-HPA057402)
Datasheet Anti NMNAT3 pAb (ATL-HPA057402) Datasheet (External Link)
Vendor Page Anti NMNAT3 pAb (ATL-HPA057402)