Anti NMNAT1 pAb (ATL-HPA059447)

Atlas Antibodies

SKU: ATL-HPA059447-100

• 
• 
• 

Protein Description: nicotinamide nucleotide adenylyltransferase 1
Gene Name: NMNAT1
Alternative Gene Name: LCA9, NMNAT, PNAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
• Gene Sequence: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
• Gene ID - Mouse: ENSMUSG00000028992
• Gene ID - Rat: ENSRNOG00000015962
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NMNAT1 pAb (ATL-HPA059447) – 1 Found

Clausing, Maximilian; William, Doreen; Preussler, Matthias; Biedermann, Julia; Grützmann, Konrad; Richter, Susan; Buchholz, Frank; Temme, Achim; Schröck, Evelin; Klink, Barbara. Different Effects of RNAi-Mediated Downregulation or Chemical Inhibition of NAMPT in an Isogenic IDH Mutant and Wild-Type Glioma Cell Model. International Journal Of Molecular Sciences. 2022;23(10)