Anti NMNAT1 pAb (ATL-HPA059447)

Atlas Antibodies

Catalog No.:
ATL-HPA059447-100
Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: nicotinamide nucleotide adenylyltransferase 1
Gene Name: NMNAT1
Alternative Gene Name: LCA9, NMNAT, PNAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Gene Sequence LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Gene ID - Mouse ENSMUSG00000028992
Gene ID - Rat ENSRNOG00000015962
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NMNAT1 pAb (ATL-HPA059447)
Datasheet Anti NMNAT1 pAb (ATL-HPA059447) Datasheet (External Link)
Vendor Page Anti NMNAT1 pAb (ATL-HPA059447) at Atlas Antibodies

Documents & Links for Anti NMNAT1 pAb (ATL-HPA059447)
Datasheet Anti NMNAT1 pAb (ATL-HPA059447) Datasheet (External Link)
Vendor Page Anti NMNAT1 pAb (ATL-HPA059447)
Citations for Anti NMNAT1 pAb (ATL-HPA059447) – 1 Found
Clausing, Maximilian; William, Doreen; Preussler, Matthias; Biedermann, Julia; Grützmann, Konrad; Richter, Susan; Buchholz, Frank; Temme, Achim; Schröck, Evelin; Klink, Barbara. Different Effects of RNAi-Mediated Downregulation or Chemical Inhibition of NAMPT in an Isogenic IDH Mutant and Wild-Type Glioma Cell Model. International Journal Of Molecular Sciences. 2022;23(10)  PubMed
!