Anti NMNAT1 pAb (ATL-HPA059447)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059447-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NMNAT1
Alternative Gene Name: LCA9, NMNAT, PNAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD |
| Gene Sequence | LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD |
| Gene ID - Mouse | ENSMUSG00000028992 |
| Gene ID - Rat | ENSRNOG00000015962 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NMNAT1 pAb (ATL-HPA059447) | |
| Datasheet | Anti NMNAT1 pAb (ATL-HPA059447) Datasheet (External Link) |
| Vendor Page | Anti NMNAT1 pAb (ATL-HPA059447) at Atlas Antibodies |
| Documents & Links for Anti NMNAT1 pAb (ATL-HPA059447) | |
| Datasheet | Anti NMNAT1 pAb (ATL-HPA059447) Datasheet (External Link) |
| Vendor Page | Anti NMNAT1 pAb (ATL-HPA059447) |
| Citations for Anti NMNAT1 pAb (ATL-HPA059447) – 1 Found |
| Clausing, Maximilian; William, Doreen; Preussler, Matthias; Biedermann, Julia; Grützmann, Konrad; Richter, Susan; Buchholz, Frank; Temme, Achim; Schröck, Evelin; Klink, Barbara. Different Effects of RNAi-Mediated Downregulation or Chemical Inhibition of NAMPT in an Isogenic IDH Mutant and Wild-Type Glioma Cell Model. International Journal Of Molecular Sciences. 2022;23(10) PubMed |