Anti NME5 pAb (ATL-HPA035648)

Atlas Antibodies

Catalog No.:
ATL-HPA035648-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NME/NM23 family member 5
Gene Name: NME5
Alternative Gene Name: nm23-H5, RSPH23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035984: 79%, ENSRNOG00000020118: 85%
Entrez Gene ID: 8382
Uniprot ID: P56597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Gene Sequence FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Gene ID - Mouse ENSMUSG00000035984
Gene ID - Rat ENSRNOG00000020118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NME5 pAb (ATL-HPA035648)
Datasheet Anti NME5 pAb (ATL-HPA035648) Datasheet (External Link)
Vendor Page Anti NME5 pAb (ATL-HPA035648) at Atlas Antibodies

Documents & Links for Anti NME5 pAb (ATL-HPA035648)
Datasheet Anti NME5 pAb (ATL-HPA035648) Datasheet (External Link)
Vendor Page Anti NME5 pAb (ATL-HPA035648)