Anti NME5 pAb (ATL-HPA035648)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035648-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NME5
Alternative Gene Name: nm23-H5, RSPH23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035984: 79%, ENSRNOG00000020118: 85%
Entrez Gene ID: 8382
Uniprot ID: P56597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI |
| Gene Sequence | FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI |
| Gene ID - Mouse | ENSMUSG00000035984 |
| Gene ID - Rat | ENSRNOG00000020118 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NME5 pAb (ATL-HPA035648) | |
| Datasheet | Anti NME5 pAb (ATL-HPA035648) Datasheet (External Link) |
| Vendor Page | Anti NME5 pAb (ATL-HPA035648) at Atlas Antibodies |
| Documents & Links for Anti NME5 pAb (ATL-HPA035648) | |
| Datasheet | Anti NME5 pAb (ATL-HPA035648) Datasheet (External Link) |
| Vendor Page | Anti NME5 pAb (ATL-HPA035648) |