Anti NLRP8 pAb (ATL-HPA056989)

Atlas Antibodies

Catalog No.:
ATL-HPA056989-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NLR family, pyrin domain containing 8
Gene Name: NLRP8
Alternative Gene Name: CLR19.2, NALP8, NOD16, PAN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058046: 25%, ENSRNOG00000023847: 26%
Entrez Gene ID: 126205
Uniprot ID: Q86W28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
Gene Sequence EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
Gene ID - Mouse ENSMUSG00000058046
Gene ID - Rat ENSRNOG00000023847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NLRP8 pAb (ATL-HPA056989)
Datasheet Anti NLRP8 pAb (ATL-HPA056989) Datasheet (External Link)
Vendor Page Anti NLRP8 pAb (ATL-HPA056989) at Atlas Antibodies

Documents & Links for Anti NLRP8 pAb (ATL-HPA056989)
Datasheet Anti NLRP8 pAb (ATL-HPA056989) Datasheet (External Link)
Vendor Page Anti NLRP8 pAb (ATL-HPA056989)