Anti NLRP8 pAb (ATL-HPA056989)

Atlas Antibodies

Catalog No.: ATL-HPA056989-25

Protein Description: NLR family, pyrin domain containing 8
Gene Name: NLRP8
Alternative Gene Name: CLR19.2, NALP8, NOD16, PAN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058046: 25%, ENSRNOG00000023847: 26%
Entrez Gene ID: 126205
Uniprot ID: Q86W28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
• Gene Sequence: EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
• Gene ID - Mouse: ENSMUSG00000058046
• Gene ID - Rat: ENSRNOG00000023847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.