Anti NLRP6 pAb (ATL-HPA048500)

Atlas Antibodies

SKU: ATL-HPA048500-25

• 

Protein Description: NLR family, pyrin domain containing 6
Gene Name: NLRP6
Alternative Gene Name: CLR11.4, NALP6, PAN3, PYPAF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038745: 69%, ENSRNOG00000045677: 71%
Entrez Gene ID: 171389
Uniprot ID: P59044
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLSHCKLPDAVCRDLSEALRAAPALTELGLLHNRLSEAGLRMLSEGLAWPQCRVQTVRVQLPDPQRGLQYLVGMLRQSPALTTLDLSGCQLPAPMVTYLCAVL
• Gene Sequence: TLSHCKLPDAVCRDLSEALRAAPALTELGLLHNRLSEAGLRMLSEGLAWPQCRVQTVRVQLPDPQRGLQYLVGMLRQSPALTTLDLSGCQLPAPMVTYLCAVL
• Gene ID - Mouse: ENSMUSG00000038745
• Gene ID - Rat: ENSRNOG00000045677
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.