Anti NLRP6 pAb (ATL-HPA043681)

Atlas Antibodies

Catalog No.:
ATL-HPA043681-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NLR family, pyrin domain containing 6
Gene Name: NLRP6
Alternative Gene Name: CLR11.4, NALP6, PAN3, PYPAF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038745: 63%, ENSRNOG00000045677: 65%
Entrez Gene ID: 171389
Uniprot ID: P59044
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLFQ
Gene Sequence GEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLFQ
Gene ID - Mouse ENSMUSG00000038745
Gene ID - Rat ENSRNOG00000045677
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NLRP6 pAb (ATL-HPA043681)
Datasheet Anti NLRP6 pAb (ATL-HPA043681) Datasheet (External Link)
Vendor Page Anti NLRP6 pAb (ATL-HPA043681) at Atlas Antibodies

Documents & Links for Anti NLRP6 pAb (ATL-HPA043681)
Datasheet Anti NLRP6 pAb (ATL-HPA043681) Datasheet (External Link)
Vendor Page Anti NLRP6 pAb (ATL-HPA043681)