Anti NLRP4 pAb (ATL-HPA062128)

Atlas Antibodies

Catalog No.:
ATL-HPA062128-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NLR family pyrin domain containing 4
Gene Name: NLRP4
Alternative Gene Name: CLR19.5, CT58, FLJ32126, NALP4, PAN2, PYPAF4, RNH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045693: 47%, ENSRNOG00000021996: 48%
Entrez Gene ID: 147945
Uniprot ID: Q96MN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
Gene Sequence FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
Gene ID - Mouse ENSMUSG00000045693
Gene ID - Rat ENSRNOG00000021996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NLRP4 pAb (ATL-HPA062128)
Datasheet Anti NLRP4 pAb (ATL-HPA062128) Datasheet (External Link)
Vendor Page Anti NLRP4 pAb (ATL-HPA062128) at Atlas Antibodies

Documents & Links for Anti NLRP4 pAb (ATL-HPA062128)
Datasheet Anti NLRP4 pAb (ATL-HPA062128) Datasheet (External Link)
Vendor Page Anti NLRP4 pAb (ATL-HPA062128)