Anti NLRP4 pAb (ATL-HPA062128)

Atlas Antibodies

Catalog No.: ATL-HPA062128-25

Protein Description: NLR family pyrin domain containing 4
Gene Name: NLRP4
Alternative Gene Name: CLR19.5, CT58, FLJ32126, NALP4, PAN2, PYPAF4, RNH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045693: 47%, ENSRNOG00000021996: 48%
Entrez Gene ID: 147945
Uniprot ID: Q96MN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
• Gene Sequence: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
• Gene ID - Mouse: ENSMUSG00000045693
• Gene ID - Rat: ENSRNOG00000021996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.