Anti NKX2-8 pAb (ATL-HPA062879)

Atlas Antibodies

Catalog No.: ATL-HPA062879-25

Protein Description: NK2 homeobox 8
Gene Name: NKX2-8
Alternative Gene Name: Nkx2-9, NKX2.8, NKX2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058669: 67%, ENSRNOG00000022970: 69%
Entrez Gene ID: 26257
Uniprot ID: O15522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR
• Gene Sequence: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR
• Gene ID - Mouse: ENSMUSG00000058669
• Gene ID - Rat: ENSRNOG00000022970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.