Anti NKX2-4 pAb (ATL-HPA074996)

Atlas Antibodies

Catalog No.:
ATL-HPA074996-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NK2 homeobox 4
Gene Name: NKX2-4
Alternative Gene Name: NKX2.4, NKX2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054160: 97%, ENSRNOG00000012647: 97%
Entrez Gene ID: 644524
Uniprot ID: Q9H2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPL
Gene Sequence RYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPL
Gene ID - Mouse ENSMUSG00000054160
Gene ID - Rat ENSRNOG00000012647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NKX2-4 pAb (ATL-HPA074996)
Datasheet Anti NKX2-4 pAb (ATL-HPA074996) Datasheet (External Link)
Vendor Page Anti NKX2-4 pAb (ATL-HPA074996) at Atlas Antibodies

Documents & Links for Anti NKX2-4 pAb (ATL-HPA074996)
Datasheet Anti NKX2-4 pAb (ATL-HPA074996) Datasheet (External Link)
Vendor Page Anti NKX2-4 pAb (ATL-HPA074996)