Anti NKTR pAb (ATL-HPA051576)

Atlas Antibodies

Catalog No.:
ATL-HPA051576-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: natural killer cell triggering receptor
Gene Name: NKTR
Alternative Gene Name: p104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032525: 73%, ENSRNOG00000049128: 72%
Entrez Gene ID: 4820
Uniprot ID: P30414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMSESKVLGEVGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQGLRIEIKSKNKVRPGSLFDEV
Gene Sequence SMSESKVLGEVGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQGLRIEIKSKNKVRPGSLFDEV
Gene ID - Mouse ENSMUSG00000032525
Gene ID - Rat ENSRNOG00000049128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NKTR pAb (ATL-HPA051576)
Datasheet Anti NKTR pAb (ATL-HPA051576) Datasheet (External Link)
Vendor Page Anti NKTR pAb (ATL-HPA051576) at Atlas Antibodies

Documents & Links for Anti NKTR pAb (ATL-HPA051576)
Datasheet Anti NKTR pAb (ATL-HPA051576) Datasheet (External Link)
Vendor Page Anti NKTR pAb (ATL-HPA051576)