Anti NKTR pAb (ATL-HPA051576)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051576-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NKTR
Alternative Gene Name: p104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032525: 73%, ENSRNOG00000049128: 72%
Entrez Gene ID: 4820
Uniprot ID: P30414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMSESKVLGEVGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQGLRIEIKSKNKVRPGSLFDEV |
Gene Sequence | SMSESKVLGEVGKQDSSSASLASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQGLRIEIKSKNKVRPGSLFDEV |
Gene ID - Mouse | ENSMUSG00000032525 |
Gene ID - Rat | ENSRNOG00000049128 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NKTR pAb (ATL-HPA051576) | |
Datasheet | Anti NKTR pAb (ATL-HPA051576) Datasheet (External Link) |
Vendor Page | Anti NKTR pAb (ATL-HPA051576) at Atlas Antibodies |
Documents & Links for Anti NKTR pAb (ATL-HPA051576) | |
Datasheet | Anti NKTR pAb (ATL-HPA051576) Datasheet (External Link) |
Vendor Page | Anti NKTR pAb (ATL-HPA051576) |