Anti NKTR pAb (ATL-HPA022120)

Atlas Antibodies

Catalog No.: ATL-HPA022120-25

Protein Description: natural killer cell triggering receptor
Gene Name: NKTR
Alternative Gene Name: p104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032525: 42%, ENSRNOG00000049128: 43%
Entrez Gene ID: 4820
Uniprot ID: P30414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT
• Gene Sequence: SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT
• Gene ID - Mouse: ENSMUSG00000032525
• Gene ID - Rat: ENSRNOG00000049128
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NKTR pAb (ATL-HPA022120) – 1 Found

Bai, Rui; Shi, Zhong; Li, Dan; Zhou, Donger; Ge, Wei-Ting; Zheng, Shu. Gene expression profile of human colorectal cancer identified NKTR as a biomarker for liver metastasis. Aging. 2022;14(16):6656-6667.