Anti NKD2 pAb (ATL-HPA049463)

Atlas Antibodies

Catalog No.:
ATL-HPA049463-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: naked cuticle homolog 2 (Drosophila)
Gene Name: NKD2
Alternative Gene Name: Naked2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021567: 75%, ENSRNOG00000016103: 77%
Entrez Gene ID: 85409
Uniprot ID: Q969F2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE
Gene Sequence GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE
Gene ID - Mouse ENSMUSG00000021567
Gene ID - Rat ENSRNOG00000016103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NKD2 pAb (ATL-HPA049463)
Datasheet Anti NKD2 pAb (ATL-HPA049463) Datasheet (External Link)
Vendor Page Anti NKD2 pAb (ATL-HPA049463) at Atlas Antibodies

Documents & Links for Anti NKD2 pAb (ATL-HPA049463)
Datasheet Anti NKD2 pAb (ATL-HPA049463) Datasheet (External Link)
Vendor Page Anti NKD2 pAb (ATL-HPA049463)