Anti NKD1 pAb (ATL-HPA049413)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049413-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NKD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031661: 85%, ENSRNOG00000014293: 85%
Entrez Gene ID: 85407
Uniprot ID: Q969G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIE |
| Gene Sequence | LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIE |
| Gene ID - Mouse | ENSMUSG00000031661 |
| Gene ID - Rat | ENSRNOG00000014293 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NKD1 pAb (ATL-HPA049413) | |
| Datasheet | Anti NKD1 pAb (ATL-HPA049413) Datasheet (External Link) |
| Vendor Page | Anti NKD1 pAb (ATL-HPA049413) at Atlas Antibodies |
| Documents & Links for Anti NKD1 pAb (ATL-HPA049413) | |
| Datasheet | Anti NKD1 pAb (ATL-HPA049413) Datasheet (External Link) |
| Vendor Page | Anti NKD1 pAb (ATL-HPA049413) |