Anti NKAP pAb (ATL-HPA000916)

Atlas Antibodies

Catalog No.:
ATL-HPA000916-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NFKB activating protein
Gene Name: NKAP
Alternative Gene Name: FLJ22626
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016409: 82%, ENSRNOG00000053813: 82%
Entrez Gene ID: 79576
Uniprot ID: Q8N5F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS
Gene Sequence RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS
Gene ID - Mouse ENSMUSG00000016409
Gene ID - Rat ENSRNOG00000053813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NKAP pAb (ATL-HPA000916)
Datasheet Anti NKAP pAb (ATL-HPA000916) Datasheet (External Link)
Vendor Page Anti NKAP pAb (ATL-HPA000916) at Atlas Antibodies

Documents & Links for Anti NKAP pAb (ATL-HPA000916)
Datasheet Anti NKAP pAb (ATL-HPA000916) Datasheet (External Link)
Vendor Page Anti NKAP pAb (ATL-HPA000916)