Anti NKAIN3 pAb (ATL-HPA018833)

Atlas Antibodies

Catalog No.: ATL-HPA018833-25

Protein Description: Na+/K+ transporting ATPase interacting 3
Gene Name: NKAIN3
Alternative Gene Name: FAM77D, FLJ39630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055761: 98%, ENSRNOG00000013085: 97%
Entrez Gene ID:
Uniprot ID: Q8N8D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV
• Gene Sequence: SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV
• Gene ID - Mouse: ENSMUSG00000055761
• Gene ID - Rat: ENSRNOG00000013085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.