Anti NKAIN3 pAb (ATL-HPA018833)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018833-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NKAIN3
Alternative Gene Name: FAM77D, FLJ39630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055761: 98%, ENSRNOG00000013085: 97%
Entrez Gene ID:
Uniprot ID: Q8N8D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV |
| Gene Sequence | SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV |
| Gene ID - Mouse | ENSMUSG00000055761 |
| Gene ID - Rat | ENSRNOG00000013085 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NKAIN3 pAb (ATL-HPA018833) | |
| Datasheet | Anti NKAIN3 pAb (ATL-HPA018833) Datasheet (External Link) |
| Vendor Page | Anti NKAIN3 pAb (ATL-HPA018833) at Atlas Antibodies |
| Documents & Links for Anti NKAIN3 pAb (ATL-HPA018833) | |
| Datasheet | Anti NKAIN3 pAb (ATL-HPA018833) Datasheet (External Link) |
| Vendor Page | Anti NKAIN3 pAb (ATL-HPA018833) |