Anti NIPA1 pAb (ATL-HPA023269)

Atlas Antibodies

Catalog No.: ATL-HPA023269-25

Protein Description: non imprinted in Prader-Willi/Angelman syndrome 1
Gene Name: NIPA1
Alternative Gene Name: MGC35570, SPG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047037: 100%, ENSRNOG00000042702: 100%
Entrez Gene ID: 123606
Uniprot ID: Q7RTP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA
• Gene Sequence: HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA
• Gene ID - Mouse: ENSMUSG00000047037
• Gene ID - Rat: ENSRNOG00000042702
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.