Anti NIP7 pAb (ATL-HPA040856)

Atlas Antibodies

Catalog No.:
ATL-HPA040856-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: NIP7, nucleolar pre-rRNA processing protein
Gene Name: NIP7
Alternative Gene Name: CGI-37, FLJ10296, HSPC031, KD93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031917: 99%, ENSRNOG00000020391: 98%
Entrez Gene ID: 51388
Uniprot ID: Q9Y221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Gene Sequence APYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Gene ID - Mouse ENSMUSG00000031917
Gene ID - Rat ENSRNOG00000020391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NIP7 pAb (ATL-HPA040856)
Datasheet Anti NIP7 pAb (ATL-HPA040856) Datasheet (External Link)
Vendor Page Anti NIP7 pAb (ATL-HPA040856) at Atlas Antibodies

Documents & Links for Anti NIP7 pAb (ATL-HPA040856)
Datasheet Anti NIP7 pAb (ATL-HPA040856) Datasheet (External Link)
Vendor Page Anti NIP7 pAb (ATL-HPA040856)