Anti NINJ2 pAb (ATL-HPA058980)

Atlas Antibodies

Catalog No.:
ATL-HPA058980-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ninjurin 2
Gene Name: NINJ2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 28%, ENSRNOG00000031643: 32%
Entrez Gene ID: 4815
Uniprot ID: Q9NZG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGLSRQLCALSHPKKAAETQTAEPGGAHAVCSRHPVRVKGLEGSEMESARENIDLQPGSSDPRSQPINLN
Gene Sequence MAGLSRQLCALSHPKKAAETQTAEPGGAHAVCSRHPVRVKGLEGSEMESARENIDLQPGSSDPRSQPINLN
Gene ID - Mouse ENSMUSG00000033871
Gene ID - Rat ENSRNOG00000031643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NINJ2 pAb (ATL-HPA058980)
Datasheet Anti NINJ2 pAb (ATL-HPA058980) Datasheet (External Link)
Vendor Page Anti NINJ2 pAb (ATL-HPA058980) at Atlas Antibodies

Documents & Links for Anti NINJ2 pAb (ATL-HPA058980)
Datasheet Anti NINJ2 pAb (ATL-HPA058980) Datasheet (External Link)
Vendor Page Anti NINJ2 pAb (ATL-HPA058980)