Anti NIN pAb (ATL-HPA005939)

Atlas Antibodies

Catalog No.:
ATL-HPA005939-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ninein (GSK3B interacting protein)
Gene Name: NIN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021068: 79%, ENSRNOG00000049104: 74%
Entrez Gene ID: 51199
Uniprot ID: Q8N4C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Gene Sequence EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Gene ID - Mouse ENSMUSG00000021068
Gene ID - Rat ENSRNOG00000049104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NIN pAb (ATL-HPA005939)
Datasheet Anti NIN pAb (ATL-HPA005939) Datasheet (External Link)
Vendor Page Anti NIN pAb (ATL-HPA005939) at Atlas Antibodies

Documents & Links for Anti NIN pAb (ATL-HPA005939)
Datasheet Anti NIN pAb (ATL-HPA005939) Datasheet (External Link)
Vendor Page Anti NIN pAb (ATL-HPA005939)