Anti NICN1 pAb (ATL-HPA058014)

Atlas Antibodies

Catalog No.:
ATL-HPA058014-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nicolin 1
Gene Name: NICN1
Alternative Gene Name: MGC12936
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032606: 89%, ENSRNOG00000049083: 87%
Entrez Gene ID: 84276
Uniprot ID: Q9BSH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT
Gene Sequence PSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT
Gene ID - Mouse ENSMUSG00000032606
Gene ID - Rat ENSRNOG00000049083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NICN1 pAb (ATL-HPA058014)
Datasheet Anti NICN1 pAb (ATL-HPA058014) Datasheet (External Link)
Vendor Page Anti NICN1 pAb (ATL-HPA058014) at Atlas Antibodies

Documents & Links for Anti NICN1 pAb (ATL-HPA058014)
Datasheet Anti NICN1 pAb (ATL-HPA058014) Datasheet (External Link)
Vendor Page Anti NICN1 pAb (ATL-HPA058014)