Anti NHLRC4 pAb (ATL-HPA077301)

Atlas Antibodies

Catalog No.:
ATL-HPA077301-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NHL repeat containing 4
Gene Name: NHLRC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090113: 78%, ENSRNOG00000039279: 76%
Entrez Gene ID: 283948
Uniprot ID: P0CG21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGPGPDGGLAVSEEFGDVRLFGSARQPLGSLGGWTGHTFGCPAGICSNSEGNVIVVDEQ
Gene Sequence VGPGPDGGLAVSEEFGDVRLFGSARQPLGSLGGWTGHTFGCPAGICSNSEGNVIVVDEQ
Gene ID - Mouse ENSMUSG00000090113
Gene ID - Rat ENSRNOG00000039279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NHLRC4 pAb (ATL-HPA077301)
Datasheet Anti NHLRC4 pAb (ATL-HPA077301) Datasheet (External Link)
Vendor Page Anti NHLRC4 pAb (ATL-HPA077301) at Atlas Antibodies

Documents & Links for Anti NHLRC4 pAb (ATL-HPA077301)
Datasheet Anti NHLRC4 pAb (ATL-HPA077301) Datasheet (External Link)
Vendor Page Anti NHLRC4 pAb (ATL-HPA077301)