Anti NHLH2 pAb (ATL-HPA055238)

Atlas Antibodies

Catalog No.:
ATL-HPA055238-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nescient helix loop helix 2
Gene Name: NHLH2
Alternative Gene Name: bHLHa34, HEN2, NSCL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048540: 95%, ENSRNOG00000054375: 94%
Entrez Gene ID: 4808
Uniprot ID: Q02577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
Gene Sequence LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
Gene ID - Mouse ENSMUSG00000048540
Gene ID - Rat ENSRNOG00000054375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NHLH2 pAb (ATL-HPA055238)
Datasheet Anti NHLH2 pAb (ATL-HPA055238) Datasheet (External Link)
Vendor Page Anti NHLH2 pAb (ATL-HPA055238) at Atlas Antibodies

Documents & Links for Anti NHLH2 pAb (ATL-HPA055238)
Datasheet Anti NHLH2 pAb (ATL-HPA055238) Datasheet (External Link)
Vendor Page Anti NHLH2 pAb (ATL-HPA055238)
Citations for Anti NHLH2 pAb (ATL-HPA055238) – 1 Found
Pebworth, Mark-Phillip; Ross, Jayden; Andrews, Madeline; Bhaduri, Aparna; Kriegstein, Arnold R. Human intermediate progenitor diversity during cortical development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(26)  PubMed