Anti NFYB pAb (ATL-HPA065646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065646-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NFYB
Alternative Gene Name: CBF-A, HAP3, NF-YB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020248: 98%, ENSRNOG00000010309: 98%
Entrez Gene ID: 4801
Uniprot ID: P25208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS |
| Gene Sequence | QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS |
| Gene ID - Mouse | ENSMUSG00000020248 |
| Gene ID - Rat | ENSRNOG00000010309 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFYB pAb (ATL-HPA065646) | |
| Datasheet | Anti NFYB pAb (ATL-HPA065646) Datasheet (External Link) |
| Vendor Page | Anti NFYB pAb (ATL-HPA065646) at Atlas Antibodies |
| Documents & Links for Anti NFYB pAb (ATL-HPA065646) | |
| Datasheet | Anti NFYB pAb (ATL-HPA065646) Datasheet (External Link) |
| Vendor Page | Anti NFYB pAb (ATL-HPA065646) |