Anti NFYB pAb (ATL-HPA065646)

Atlas Antibodies

Catalog No.:
ATL-HPA065646-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nuclear transcription factor Y subunit beta
Gene Name: NFYB
Alternative Gene Name: CBF-A, HAP3, NF-YB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020248: 98%, ENSRNOG00000010309: 98%
Entrez Gene ID: 4801
Uniprot ID: P25208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
Gene Sequence QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
Gene ID - Mouse ENSMUSG00000020248
Gene ID - Rat ENSRNOG00000010309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFYB pAb (ATL-HPA065646)
Datasheet Anti NFYB pAb (ATL-HPA065646) Datasheet (External Link)
Vendor Page Anti NFYB pAb (ATL-HPA065646) at Atlas Antibodies

Documents & Links for Anti NFYB pAb (ATL-HPA065646)
Datasheet Anti NFYB pAb (ATL-HPA065646) Datasheet (External Link)
Vendor Page Anti NFYB pAb (ATL-HPA065646)