Anti NFXL1 pAb (ATL-HPA059132)

Atlas Antibodies

Catalog No.:
ATL-HPA059132-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nuclear transcription factor, X-box binding-like 1
Gene Name: NFXL1
Alternative Gene Name: HOZFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072889: 98%, ENSRNOG00000058588: 97%
Entrez Gene ID: 152518
Uniprot ID: Q6ZNB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEYKRSETPS
Gene Sequence LERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWPCPKCRFEYKRSETPS
Gene ID - Mouse ENSMUSG00000072889
Gene ID - Rat ENSRNOG00000058588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFXL1 pAb (ATL-HPA059132)
Datasheet Anti NFXL1 pAb (ATL-HPA059132) Datasheet (External Link)
Vendor Page Anti NFXL1 pAb (ATL-HPA059132) at Atlas Antibodies

Documents & Links for Anti NFXL1 pAb (ATL-HPA059132)
Datasheet Anti NFXL1 pAb (ATL-HPA059132) Datasheet (External Link)
Vendor Page Anti NFXL1 pAb (ATL-HPA059132)