Anti NFKBIB pAb (ATL-HPA063734)

Atlas Antibodies

Catalog No.:
ATL-HPA063734-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Gene Name: NFKBIB
Alternative Gene Name: IKBB, TRIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030595: 89%, ENSRNOG00000020063: 86%
Entrez Gene ID: 4793
Uniprot ID: Q15653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL
Gene Sequence EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL
Gene ID - Mouse ENSMUSG00000030595
Gene ID - Rat ENSRNOG00000020063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFKBIB pAb (ATL-HPA063734)
Datasheet Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link)
Vendor Page Anti NFKBIB pAb (ATL-HPA063734) at Atlas Antibodies

Documents & Links for Anti NFKBIB pAb (ATL-HPA063734)
Datasheet Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link)
Vendor Page Anti NFKBIB pAb (ATL-HPA063734)