Anti NFKBIB pAb (ATL-HPA063734)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063734-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NFKBIB
Alternative Gene Name: IKBB, TRIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030595: 89%, ENSRNOG00000020063: 86%
Entrez Gene ID: 4793
Uniprot ID: Q15653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL |
| Gene Sequence | EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL |
| Gene ID - Mouse | ENSMUSG00000030595 |
| Gene ID - Rat | ENSRNOG00000020063 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFKBIB pAb (ATL-HPA063734) | |
| Datasheet | Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link) |
| Vendor Page | Anti NFKBIB pAb (ATL-HPA063734) at Atlas Antibodies |
| Documents & Links for Anti NFKBIB pAb (ATL-HPA063734) | |
| Datasheet | Anti NFKBIB pAb (ATL-HPA063734) Datasheet (External Link) |
| Vendor Page | Anti NFKBIB pAb (ATL-HPA063734) |