Anti NFKBIA pAb (ATL-HPA029207)

Atlas Antibodies

Catalog No.:
ATL-HPA029207-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha
Gene Name: NFKBIA
Alternative Gene Name: IkappaBalpha, IKBA, MAD-3, NFKBI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021025: 89%, ENSRNOG00000007390: 88%
Entrez Gene ID: 4792
Uniprot ID: P25963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG
Gene Sequence MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG
Gene ID - Mouse ENSMUSG00000021025
Gene ID - Rat ENSRNOG00000007390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFKBIA pAb (ATL-HPA029207)
Datasheet Anti NFKBIA pAb (ATL-HPA029207) Datasheet (External Link)
Vendor Page Anti NFKBIA pAb (ATL-HPA029207) at Atlas Antibodies

Documents & Links for Anti NFKBIA pAb (ATL-HPA029207)
Datasheet Anti NFKBIA pAb (ATL-HPA029207) Datasheet (External Link)
Vendor Page Anti NFKBIA pAb (ATL-HPA029207)
Citations for Anti NFKBIA pAb (ATL-HPA029207) – 1 Found
Chen, Zhi; Dong, Wei-Hua; Wu, Qi; Wang, Jun. Two-layer regulation of TRAF6 mediated by both TLR4/NF-kB signaling and miR-589-5p increases proinflammatory cytokines in the pathology of severe acute pancreatitis. American Journal Of Translational Research. 12(6):2379-2395.  PubMed