Anti NFKBIA pAb (ATL-HPA029207)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029207-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: NFKBIA
Alternative Gene Name: IkappaBalpha, IKBA, MAD-3, NFKBI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021025: 89%, ENSRNOG00000007390: 88%
Entrez Gene ID: 4792
Uniprot ID: P25963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG |
| Gene Sequence | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRG |
| Gene ID - Mouse | ENSMUSG00000021025 |
| Gene ID - Rat | ENSRNOG00000007390 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFKBIA pAb (ATL-HPA029207) | |
| Datasheet | Anti NFKBIA pAb (ATL-HPA029207) Datasheet (External Link) |
| Vendor Page | Anti NFKBIA pAb (ATL-HPA029207) at Atlas Antibodies |
| Documents & Links for Anti NFKBIA pAb (ATL-HPA029207) | |
| Datasheet | Anti NFKBIA pAb (ATL-HPA029207) Datasheet (External Link) |
| Vendor Page | Anti NFKBIA pAb (ATL-HPA029207) |
| Citations for Anti NFKBIA pAb (ATL-HPA029207) – 1 Found |
| Chen, Zhi; Dong, Wei-Hua; Wu, Qi; Wang, Jun. Two-layer regulation of TRAF6 mediated by both TLR4/NF-kB signaling and miR-589-5p increases proinflammatory cytokines in the pathology of severe acute pancreatitis. American Journal Of Translational Research. 12(6):2379-2395. PubMed |