Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055889-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear factor, erythroid 2-like 3
Gene Name: NFE2L3
Alternative Gene Name: Nrf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029832: 67%, ENSRNOG00000010886: 58%
Entrez Gene ID: 9603
Uniprot ID: Q9Y4A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
Gene Sequence LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
Gene ID - Mouse ENSMUSG00000029832
Gene ID - Rat ENSRNOG00000010886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation)
Datasheet Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation)
Datasheet Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation)
Citations for Anti NFE2L3 pAb (ATL-HPA055889 w/enhanced validation) – 5 Found
Wang, Chaojie; Saji, Motoyasu; Justiniano, Steven E; Yusof, Adlina Mohd; Zhang, Xiaoli; Yu, Lianbo; Fernández, Soledad; Wakely, Paul Jr; La Perle, Krista; Nakanishi, Hiroshi; Pohlman, Neal; Ringel, Matthew D. RCAN1-4 is a thyroid cancer growth and metastasis suppressor. Jci Insight. 2017;2(5):e90651.  PubMed
Dai, Yue-Chu; Pan, Yin; Quan, Ming-Ming; Chen, Qi; Pan, Yue; Ruan, Yan-Yun; Sun, Jian-Guo. MicroRNA-1246 Mediates Drug Resistance and Metastasis in Breast Cancer by Targeting NFE2L3. Frontiers In Oncology. 11( 34926237):677168.  PubMed
Immonen, Anni; Haapasaari, Kirsi-Maria; Skarp, Sini; Karihtala, Peeter; Teppo, Hanna-Riikka. NRF3 Decreases during Melanoma Carcinogenesis and Is an Independent Prognostic Marker in Melanoma. Oxidative Medicine And Cellular Longevity. 2022( 35378827):2240223.  PubMed
Wang, Hui; Zhan, Ming; Yang, Ruimeng; Shi, Yongheng; Liu, Qiang; Wang, Jian. Elevated expression of NFE2L3 predicts the poor prognosis of pancreatic cancer patients. Cell Cycle (Georgetown, Tex.). 17(17):2164-2174.  PubMed
Kobayashi, Akira. Roles of NRF3 in the Hallmarks of Cancer: Proteasomal Inactivation of Tumor Suppressors. Cancers. 2020;12(9)  PubMed