Anti NFE2L1 pAb (ATL-HPA065424)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065424-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NFE2L1
Alternative Gene Name: FLJ00380, LCR-F1, NRF1, TCF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038615: 99%, ENSRNOG00000001548: 51%
Entrez Gene ID: 4779
Uniprot ID: Q14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP |
| Gene Sequence | LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP |
| Gene ID - Mouse | ENSMUSG00000038615 |
| Gene ID - Rat | ENSRNOG00000001548 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424) | |
| Datasheet | Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link) |
| Vendor Page | Anti NFE2L1 pAb (ATL-HPA065424) at Atlas Antibodies |
| Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424) | |
| Datasheet | Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link) |
| Vendor Page | Anti NFE2L1 pAb (ATL-HPA065424) |