Anti NFE2L1 pAb (ATL-HPA065424)

Atlas Antibodies

Catalog No.:
ATL-HPA065424-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nuclear factor, erythroid 2-like 1
Gene Name: NFE2L1
Alternative Gene Name: FLJ00380, LCR-F1, NRF1, TCF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038615: 99%, ENSRNOG00000001548: 51%
Entrez Gene ID: 4779
Uniprot ID: Q14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Gene Sequence LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Gene ID - Mouse ENSMUSG00000038615
Gene ID - Rat ENSRNOG00000001548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424)
Datasheet Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link)
Vendor Page Anti NFE2L1 pAb (ATL-HPA065424) at Atlas Antibodies

Documents & Links for Anti NFE2L1 pAb (ATL-HPA065424)
Datasheet Anti NFE2L1 pAb (ATL-HPA065424) Datasheet (External Link)
Vendor Page Anti NFE2L1 pAb (ATL-HPA065424)