Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001914-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NFE2
Alternative Gene Name: NF-E2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058794: 82%, ENSRNOG00000036837: 85%
Entrez Gene ID: 4778
Uniprot ID: Q16621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES |
Gene Sequence | SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES |
Gene ID - Mouse | ENSMUSG00000058794 |
Gene ID - Rat | ENSRNOG00000036837 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) | |
Datasheet | Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) | |
Datasheet | Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) |
Citations for Anti NFE2 pAb (ATL-HPA001914 w/enhanced validation) – 2 Found |
Lahon, Anismrita; Arya, Ravi P; Banerjea, Akhil C. Dengue Virus Dysregulates Master Transcription Factors and PI3K/AKT/mTOR Signaling Pathway in Megakaryocytes. Frontiers In Cellular And Infection Microbiology. 11( 34513730):715208. PubMed |
Aumann, Konrad; Frey, Anna-Verena; May, Annette M; Hauschke, Dieter; Kreutz, Clemens; Marx, Jan P; Timmer, Jens; Werner, Martin; Pahl, Heike L. Subcellular mislocalization of the transcription factor NF-E2 in erythroid cells discriminates prefibrotic primary myelofibrosis from essential thrombocythemia. Blood. 2013;122(1):93-9. PubMed |