Anti NFAT5 pAb (ATL-HPA069711)

Atlas Antibodies

Catalog No.:
ATL-HPA069711-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nuclear factor of activated T-cells 5, tonicity-responsive
Gene Name: NFAT5
Alternative Gene Name: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003847: 100%, ENSRNOG00000011879: 100%
Entrez Gene ID: 10725
Uniprot ID: O94916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
Gene Sequence SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
Gene ID - Mouse ENSMUSG00000003847
Gene ID - Rat ENSRNOG00000011879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NFAT5 pAb (ATL-HPA069711)
Datasheet Anti NFAT5 pAb (ATL-HPA069711) Datasheet (External Link)
Vendor Page Anti NFAT5 pAb (ATL-HPA069711) at Atlas Antibodies

Documents & Links for Anti NFAT5 pAb (ATL-HPA069711)
Datasheet Anti NFAT5 pAb (ATL-HPA069711) Datasheet (External Link)
Vendor Page Anti NFAT5 pAb (ATL-HPA069711)
Citations for Anti NFAT5 pAb (ATL-HPA069711) – 2 Found
Qin, Xian; Li, Changsheng; Guo, Tao; Chen, Jing; Wang, Hai-Tao; Wang, Yi-Tao; Xiao, Yu-Sha; Li, Jun; Liu, Pengpeng; Liu, Zhi-Su; Liu, Quan-Yan. Upregulation of DARS2 by HBV promotes hepatocarcinogenesis through the miR-30e-5p/MAPK/NFAT5 pathway. Journal Of Experimental & Clinical Cancer Research : Cr. 2017;36(1):148.  PubMed
Topalov, Nicole Elisabeth; Mayr, Doris; Scherer, Clemens; Chelariu-Raicu, Anca; Beyer, Susanne; Hester, Anna; Kraus, Fabian; Zheng, Mingjun; Kaltofen, Till; Kolben, Thomas; Burges, Alexander; Mahner, Sven; Trillsch, Fabian; Jeschke, Udo; Czogalla, Bastian. Actin Beta-Like 2 as a New Mediator of Proliferation and Migration in Epithelial Ovarian Cancer. Frontiers In Oncology. 11( 34631538):713026.  PubMed