Anti NEURL4 pAb (ATL-HPA055314)

Atlas Antibodies

Catalog No.:
ATL-HPA055314-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: neuralized E3 ubiquitin protein ligase 4
Gene Name: NEURL4
Alternative Gene Name: KIAA1787
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047284: 100%, ENSRNOG00000016109: 100%
Entrez Gene ID: 84461
Uniprot ID: Q96JN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLRDNEMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRREYCEFSLDELQEGDHIGLTRKSNSALHF
Gene Sequence PLRDNEMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGTRREYCEFSLDELQEGDHIGLTRKSNSALHF
Gene ID - Mouse ENSMUSG00000047284
Gene ID - Rat ENSRNOG00000016109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEURL4 pAb (ATL-HPA055314)
Datasheet Anti NEURL4 pAb (ATL-HPA055314) Datasheet (External Link)
Vendor Page Anti NEURL4 pAb (ATL-HPA055314) at Atlas Antibodies

Documents & Links for Anti NEURL4 pAb (ATL-HPA055314)
Datasheet Anti NEURL4 pAb (ATL-HPA055314) Datasheet (External Link)
Vendor Page Anti NEURL4 pAb (ATL-HPA055314)
Citations for Anti NEURL4 pAb (ATL-HPA055314) – 1 Found
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed