Anti NETO1 pAb (ATL-HPA064630)

Atlas Antibodies

Catalog No.:
ATL-HPA064630-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neuropilin (NRP) and tolloid (TLL)-like 1
Gene Name: NETO1
Alternative Gene Name: BCTL1, BTCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050321: 100%, ENSRNOG00000014006: 100%
Entrez Gene ID: 81832
Uniprot ID: Q8TDF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKD
Gene Sequence PIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKD
Gene ID - Mouse ENSMUSG00000050321
Gene ID - Rat ENSRNOG00000014006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NETO1 pAb (ATL-HPA064630)
Datasheet Anti NETO1 pAb (ATL-HPA064630) Datasheet (External Link)
Vendor Page Anti NETO1 pAb (ATL-HPA064630) at Atlas Antibodies

Documents & Links for Anti NETO1 pAb (ATL-HPA064630)
Datasheet Anti NETO1 pAb (ATL-HPA064630) Datasheet (External Link)
Vendor Page Anti NETO1 pAb (ATL-HPA064630)