Anti NET1 pAb (ATL-HPA020068)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020068-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/84459/153874/atl-hpa020068_anti-net1-pab-atl-hpa020068_35503__74420.1681104096.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NET1
Alternative Gene Name: ARHGEF8, NET1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021215: 55%, ENSRNOG00000017765: 52%
Entrez Gene ID: 10276
Uniprot ID: Q7Z628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETL |
| Gene Sequence | PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETL |
| Gene ID - Mouse | ENSMUSG00000021215 |
| Gene ID - Rat | ENSRNOG00000017765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NET1 pAb (ATL-HPA020068) | |
| Datasheet | Anti NET1 pAb (ATL-HPA020068) Datasheet (External Link) |
| Vendor Page | Anti NET1 pAb (ATL-HPA020068) at Atlas Antibodies |
| Documents & Links for Anti NET1 pAb (ATL-HPA020068) | |
| Datasheet | Anti NET1 pAb (ATL-HPA020068) Datasheet (External Link) |
| Vendor Page | Anti NET1 pAb (ATL-HPA020068) |
| Citations for Anti NET1 pAb (ATL-HPA020068) – 1 Found |
| Ulu, Arzu; Oh, Wonkyung; Zuo, Yan; Frost, Jeffrey A. Cdk1 phosphorylation negatively regulates the activity of Net1 towards RhoA during mitosis. Cellular Signalling. 2021;80( 33465404):109926. PubMed |